CD274 (B7-H1, PD-L1, Programmed Death Ligand) is a member of the B7 family and is expressed on a variety of tissues including lymphoid cells. It plays an important role in regulation of T cell activation, and is involved in progression of cancer, arthritis and HIV infection (3). CD274 binding to its receptor CD279 (PD-1) on activated T cells can decrease proliferation. Conversely, ligation of CD279 on primed T cells can stimulate IL-10 production. High levels of CD274 present in Renal cell carcinoma are associated with poor prognosis (1). Tumor expressed CD274 can increase apoptosis of tumor specific T cells resulting in better tumor cell survival (2). Gamma Interferon and PHA can up regulate CD274 expression on T cells.

Molecular Structure: A soluble fusion protein consisting of the murine CD8 alpha leader sequence, the mature extracellular (224aa) domain of human CD274 fused to murine IgG2a Fc + hinge (233aa).

muCD8 apha signal peptide residual amino acids+ linker: (1) kpqapelrgsas

CD274 mature EC: (224aa): (13)ftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvqhssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapynkinqrilvvdpvtseheltcqaegypkaeviwtssdhqvlsgkttttnskreeklfnvtstlrintttneifyctfrrldpeenhtaelvipelplahppnerthtr

Linker +Murine IgG2a Hinge + Fc (235 aa): (237)gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg(471)

Predicted monomeric (non glycosylated) molecular weight: 54.4 kd. The molecule is dimeric and runs at about 120 kd in SDS-PAGE under native conditions.

Transfectant Cell Line: CHO

References:

1) Cancer Research (April 2006) 66:3381.

2) J Molecular Medicine (Feb 2004) 81(5):281.

3) Int J Hematol (Nov 2003) 78(4):321.