Human CD152 (CTLA-4) is a cell surface glycoprotein expressed at low levels on activated T cells (1). CD152 is a high affinity receptor for the costimulatory molecules CD80 (B7-1) and CD86 (B7-2) and appears to function as a negative regulator of T cell activation (2, 3). A soluble fusion protein combining the extracellular (125aa) domain of human CD152 and murine IgG2a Fc (CTLA-4 Ig) was developed (4).

Molecular Structure: A soluble 110 kd dimeric fusion protein consisting of the extracellular (125aa) domain of human CTLA-4 fused to murine IgG2a Fc (233aa), with a predicted non glycosylated monomeric molecular weight of 40.1 kd.

Sequence:

CD152 mature EC: mhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymtgneltflddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngtqiyvidpepcpdsdf

+linker: gt

fused to murine IgG2a Fc (233aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk

Transfectant Cell Line: BHK

Functional Application: CD152 Ig binds with high affinity to human or mouse CD80 (B7-1) and CD86 (B7-2) (4, 5). CD152-muIg blocks the binding of anti-human CD80 (B7-1) and anti-humanCD86 (B7-2) mAbs to recepters on Raji cells. It cross reacts with CD80 and CD86 accross a broad range of mammalian species including pig (6, 7).

References:

1. T. Lindsten, et al, (1993) J Immunol 151: 3489-3499.

2. T.L. Walunas, et al, (1994) Immunity 1: 405-413.

3. N.J. Karandikar, et al, (1996) J Exp Med 184: 783-788.

4. A.H. Cross, et al, (1995) J Clin Invest 95: 2783-2789.

5. P.A. Morton, et al, (1996) J Immunol 156: 1047-1054.

6). Takamatsu H, RME Parkhouse, et al. (1999) Immunology 97(2):211-213.

7). Le Leduec JB, B Dubois, et al. (2016) Vaccine 34(7): 914-22. PMID: 26768129